Cusabio Human Recombinants
Recombinant Human Cathelicidin antimicrobial peptide (CAMP) | CSB-EP004476HUb3
- SKU:
- CSB-EP004476HUb3
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Cathelicidin antimicrobial peptide (CAMP) | CSB-EP004476HUb3 | Cusabio
Alternative Name(s): 18KDA cationic antimicrobial protein
Gene Names: CAMP
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 132-170aa
Sequence Info: Full Length of Mature Protein
MW: 24.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.
Reference: "FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis." Agerberth B., Gunne H., Odeberg J., Kogner P., Boman H.G., Gudmundsson G.H. Proc. Natl. Acad. Sci. U.S.A. 92:195-199(1995)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Cathelicidin family
Tissue Specificity: Expressed in bone marrow and testis and neutrophils.
Paythway: NOD-likereceptorsignalingpathway
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P49913
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM