Recombinant Human Cathelicidin antimicrobial peptide (CAMP) | CSB-EP004476HUb3

Recombinant Human Cathelicidin antimicrobial peptide (CAMP) | CSB-EP004476HUb3 | Cusabio

Alternative Name(s): 18KDA cationic antimicrobial protein

Gene Names: CAMP

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 132-170aa

Sequence Info: Full Length of Mature Protein

MW: 24.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.

Reference: "FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis." Agerberth B., Gunne H., Odeberg J., Kogner P., Boman H.G., Gudmundsson G.H. Proc. Natl. Acad. Sci. U.S.A. 92:195-199(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Cathelicidin family

Tissue Specificity: Expressed in bone marrow and testis and neutrophils.

Paythway: NOD-likereceptorsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P49913

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM