Recombinant Human Catechol O-methyltransferase (COMT), partial | CSB-EP005779HU

Recombinant Human Catechol O-methyltransferase (COMT), partial | CSB-EP005779HU | Cusabio

Alternative Name(s): Catechol O methyltransferase; Catechol O-methyltransferase; COMT; COMT_HUMAN; EC 2.1.1.6

Gene Names: COMT

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 52-271aa

Sequence Info: Partial

MW: 28.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.

Reference: Cloning and characterization of human placental catechol-O-methyltransferase cDNA.Lundstroem K., Salminen M., Jalanko A., Savolainen R., Ulmanen I.DNA Cell Biol. 10:181-189(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.

Involvement in disease: Schizophrenia (SCZD)

Subcellular Location: Isoform Soluble: Cytoplasm, SUBCELLULAR LOCATION: Isoform Membrane-bound: Cell membrane, Single-pass type II membrane protein, Extracellular side

Protein Families: Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family

Tissue Specificity: Brain, liver, placenta, lymphocytes and erythrocytes.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21964

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM