Recombinant Human Caspase-7 (CASP7), partial | CSB-RP154794h(A4)

(No reviews yet) Write a Review
SKU:
CSB-RP154794h(A4)
Availability:
13 - 23 Working Days
  • Recombinant Human Caspase-7 (CASP7), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Caspase-7 (CASP7), partial | CSB-RP154794h(A4) | Cusabio

Alternative Name(s): Apoptotic protease Mch-3CMH-1ICE-like apoptotic protease 3 ;ICE-LAP3

Gene Names: CASP7

Research Areas: Apoptosis

Organism: Homo sapiens (Human)

AA Sequence: ANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 207-303aa

Sequence Info: Partial

MW: 15.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory elent binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

Reference: Mch3, a novel human apoptotic cysteine protease highly related to CPP32.Fernandes-Alnemri T., Takahashi A., Armstrong R.C., Krebs J., Fritz L.C., Tomaselli K.J., Wang L., Yu Z., Croce C.M., Salveson G., Earnshaw W.C., Litwack G., Alnemri E.S.Cancer Res. 55:6045-6052(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Peptidase C14A family

Tissue Specificity: Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.

Paythway: TNFsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55210

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose