Recombinant Human Caspase-14 (CASP14) | CSB-EP004546HU

(No reviews yet) Write a Review
SKU:
CSB-EP004546HU
Availability:
13 - 23 Working Days
  • Recombinant Human Caspase-14 (CASP14)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Caspase-14 (CASP14) | CSB-EP004546HU | Cusabio

Alternative Name(s): Apoptosis related cysteine protease; CASP 14; CASP-14; CASP14; Caspase 14 apoptosis related cysteine protease; Caspase 14 precursor; Caspase-14 subunit p10; Caspase14; CASPE_HUMAN; MGC119078; MGC119079; MICE; Mini ICE

Gene Names: CASP14

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 153-240aa

Sequence Info: Full Length of Mature Protein

MW: 37.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Non-apoptotic caspase involved in epidermal differentiation. Is the predominant caspase in epidermal stratum corneum . Ses to play a role in keratinocyte differentiation and is required for cornification. Regulates maturation of the epidermis by proteolytically processing filaggrin . In vitro has a preference for the substate [WY]-X-X-D motif and is active on the synthetic caspase substrate WEHD-ACF . Involved in processing of prosaposin in the epidermis . May be involved in retinal pigment epithelium cell barrier function . Involved in DNA degradation in differentiated keratinocytes probably by cleaving DFFA/ICAD leading to liberation of DFFB/CAD .

Reference: Multiple pathways are involved in DNA degradation during keratinocyte terminal differentiation.Yamamoto-Tanaka M., Makino T., Motoyama A., Miyai M., Tsuboi R., Hibino T.Cell Death Dis. 5:E1181-E1181(2014)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Non-apoptotic caspase involved in epidermal differentiation. Is the predominant caspase in epidermal stratum corneum

Involvement in disease: Ichthyosis, congenital, autosomal recessive 12 (ARCI12)

Subcellular Location: Cytoplasm, Nucleus

Protein Families: Peptidase C14A family

Tissue Specificity: Expressed in keratinocytes of adult skin suprabasal layers (from spinous layers to the stratum granulosum and stratum corneum) (at protein level). Expressed in keratinocytes of hair shaft and sebaceous glands (at protein level). In psoriatic skin only expressed at very low levels (PubMed:11175259). The p17/10 mature form is expressed in epidermis stratum corneum, the p20/p8 intermediate form in epidermis upper granular cells of the stratum granulosum (PubMed:22825846).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P31944

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose