Recombinant Human Cardiac phospholamban (PLN) | CSB-YP018198HU

Recombinant Human Cardiac phospholamban (PLN) | CSB-YP018198HU | Cusabio

Alternative Name(s): Cardiac phospholamban; CMD1P; CMH18; PLB; Pln; PPLA_HUMAN

Gene Names: PLN

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Source: Yeast

Tag Info: N-terminal GST-tagged

Expression Region: 1-52aa

Sequence Info: Full Length

MW: 33.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca2+. Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation

Reference: "Myotonic dystrophy protein kinase phosphorylates phospholamban and regulates calcium uptake in cardiomyocyte sarcoplasmic reticulum." Kaliman P., Catalucci D., Lam J.T., Kondo R., Gutierrez J.C., Reddy S., Palacin M., Zorzano A., Chien K.R., Ruiz-Lozano P.J. Biol. Chem. 280:8016-8021(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation.

Involvement in disease: Cardiomyopathy, dilated 1P (CMD1P); Cardiomyopathy, familial hypertrophic 18 (CMH18)

Subcellular Location: Endoplasmic reticulum membrane, Single-pass membrane protein, Sarcoplasmic reticulum membrane, Single-pass membrane protein, Mitochondrion membrane, Single-pass membrane protein, Membrane, Single-pass membrane protein

Protein Families: Phospholamban family

Tissue Specificity: Heart muscle (at protein level).

Paythway: Calciumsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P26678

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM