Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) | CSB-EP005168HU

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) | CSB-EP005168HU | Cusabio

Alternative Name(s): CD67 antigen Carcinoembryonic antigen CGM6 Non-specific cross-reacting antigen NCA-95 CD_antigen: CD66b

Gene Names: CEACAM8

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 35-320aa

Sequence Info: Full Length of Mature Protein

MW: 47.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "High expression of CEACAM6 and CEACAM8 mRNA in acute lymphoblastic leukemias." Lasa A., Serrano E., Carricondo M., Carnicer M.J., Brunet S., Badell I., Sierra J., Aventin A., Nomdedeu J.F. Ann. Hematol. 87:205-211(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families: Immunoglobulin superfamily, CEA family

Tissue Specificity: Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P31997

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM