Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) | CSB-EP005166HU

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) | CSB-EP005166HU | Cusabio

Alternative Name(s): Non-specific crossreacting antigen;Normal cross-reacting antigen;CD_antigen: CD66c

Gene Names: CEACAM6

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 35-320aa

Sequence Info: Full Length of Mature Protein

MW: 47.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Characterization of a cDNA clone for the nonspecific cross-reacting antigen (NCA) and a comparison of NCA and carcinoembryonic antigen." Neumaier M., Zimmermann W., Shively L., Hinoda Y., Riggs A.D., Shively J.E.J. Biol. Chem. 263:3202-3207(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families: Immunoglobulin superfamily, CEA family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P40199

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM