Recombinant Human Carbonic anhydrase-related protein (CA8), partial (Active) | CSB-AP005421HU

(No reviews yet) Write a Review
SKU:
CSB-AP005421HU
Availability:
5 to 10 Working Days
  • Recombinant Human Carbonic anhydrase-related protein (CA8) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£140.00 - £260.80

Description

Recombinant Human Carbonic anhydrase-related protein (CA8) ,partial (Active) | CSB-AP005421HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Carbonic Anhydrase-Related Protein; CARP; Carbonic Anhydrase VIII; CA-VIII; CA8; CALS

Gene Names: CA8

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: C-terminal 6xHis-tagged

Expression Region: 2-290aa

Sequence Info: ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Biological Activity: The esterase activity is determined to be greater than 100 pmol/min/ug

MW: 34.04 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Carbonic Anhydrase 8 (CA8) belongs to the alpha-carbonic anhydrase family. Alpha-carbonic anhydrase is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. Because CA8 has some sequence similarity with other known carbonic anhydrase genes, it was firstly called as CA-related protein. Nevertheless, CA8 does not have a carbonic anhydrase catalytic activity. Defects in CA8 are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 3 (CMARQ3) , which is a congenital cerebellar ataxia associated with dysarthia, quadrupedal gait and mild mental retardation.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Does not have a carbonic anhydrase catalytic activity.

Involvement in disease: Cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3)

Subcellular Location:

Protein Families: Alpha-carbonic anhydrase family

Tissue Specificity:

Paythway:

Form: Liquid

Buffer: 0.2 μm filtered 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5

Reconstitution:

Uniprot ID: P35219

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose