Recombinant Human Calcineurin subunit B type 2 (PPP3R2) | CSB-EP856978HU

Recombinant Human Calcineurin subunit B type 2 (PPP3R2) | CSB-EP856978HU | Cusabio

Alternative Name(s): Calcineurin B-like protein

Gene Names: PPP3R2

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: GNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-170aa

Sequence Info: Full Length

MW: 46.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity

Reference: "Characterization of a human regulatory subunit of protein phosphatase 3 gene (PPP3RL) expressed specifically in testis." Liu L., Zhang J., Yuan J., Dang Y., Yang C., Chen X., Xu J., Yu L. Mol. Biol. Rep. 32:41-45(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity (By similarity).

Involvement in disease:

Subcellular Location:

Protein Families: Calcineurin regulatory subunit family

Tissue Specificity: Testis-specific.

Paythway: Calciumsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96LZ3

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM