Cusabio Active Proteins
Recombinant Human C-X-C motif chemokine 2 (CXCL2), partial (Active) | CSB-AP003541HU
- SKU:
- CSB-AP003541HU
- Availability:
- 5 to 10 Working Days
Description
Recombinant Human C-X-C motif chemokine 2 (CXCL2) ,partial (Active) | CSB-AP003541HU | Cusabio
Protein Description: Partial
Alternative Name (s) : C-X-C Motif Chemokine 2; Growth-Regulated Protein Beta; Gro-Beta; Macrophage Inflammatory Protein 2-Alpha; MIP2-Alpha; CXCL2; GRO2; GROB; MIP2A; SCYB2
Gene Names: CXCL2
Research Areas: Immunology
Species: Homo sapiens (Human)
Source: E.coli
Tag Info: Tag-Free
Expression Region: 39-107aa
Sequence Info: TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Biological Activity: The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 10 ng/mL.
MW: 7.67 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
Relevance: Chemokine Ligand 2 (CXCL2) is a small secreted cytokine which belongs to the CXC chemokine family. It is secreted by monocytes and macrophages and chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. CXCL2 mobilizes cells by interacting with a cell surface chemokine receptor called CXCR2. It has been known to regulate immune functions mainly by chemo-attracting neutrophils. It is produced by activated monocytes and neutrophils and expressed at sites of inflammation. It is a hematoregulatory chemokine, which suppresses hematopoietic progenitor cell proliferation. It can be induced by receptor activator of NF-kappaB ligand, the osteoclast (OC) differentiation factor, through JNK and NF-kappaB signaling pathways in OC precursor cells. CXCL2 in turn enhanced the proliferation of OC precursor cells of bone marrow-derived macrophages (BMMs) through the activation of ERK. Knockdown of CXCL2 inhibited both the proliferation of and the ERK activation in BMMs. During osteoclastogenesis CXCL2 stimulated the adhesion and the migration of BMMs. CXCL2 is a novel therapeutic target for inflammatory bone destructive diseases.
PubMed ID:
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Function: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta (5-73) shows a highly enhanced hematopoietic activity.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Intercrine alpha (chemokine CxC) family
Tissue Specificity:
Paythway: Chemokinesignalingpathway
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 400 mM NaCl, pH 8.5
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P19875
Uniprot Entry Name:
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM