Recombinant Human C-X-C motif chemokine 2 (CXCL2) | CSB-EP006248HU

Recombinant Human C-X-C motif chemokine 2 (CXCL2) | CSB-EP006248HU | Cusabio

Alternative Name(s): Growth-regulated protein beta;Gro-beta;Macrophage inflammatory protein 2-alpha;MIP2-alpha

Gene Names: CXCL2

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Source: E.coli

Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Expression Region: 35-107aa

Sequence Info: Full Length of Mature Protein

MW: 44.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.

Reference: "Identification of unique truncated KC/GRO beta chemokines with potent hematopoietic and anti-infective activities." King A.G., Johanson K., Frey C.L., DeMarsh P.L., White J.R., McDevitt P., McNulty D., Balcarek J., Jonak Z.L., Bhatnagar P.K., Pelus L.M. J. Immunol. 164:3774-3782(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19875

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A