Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), partial | CSB-EP006243HU1

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), partial | CSB-EP006243HU1 | Cusabio

Alternative Name(s): AngieB cell-attracting chemokine 1 ;BCA-1B lymphocyte chemoattractantCXC chemokine BLCSmall-inducible cytokine B13

Gene Names: CXCL13

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 23-95aa

Sequence Info: Partial

MW: 12.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Chotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

Reference: A B-cell-homing chemokine made in lymphoid follicles activates Burkitt's lymphoma receptor-1.Gunn M.D., Ngo V.N., Ansel K.M., Ekland E.H., Cyster J.G., Williams L.T.Nature 391:799-803(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity: Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.

Paythway: Chemokinesignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O43927

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM