Recombinant Human C-X-C motif chemokine 10 (CXCL10) | CSB-MP006240HU

(No reviews yet) Write a Review
SKU:
CSB-MP006240HU
Availability:
18 - 28 Working Days
  • Recombinant Human C-X-C motif chemokine 10 (CXCL10)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€386.00 - €900.00

Description

Recombinant Human C-X-C motif chemokine 10 (CXCL10) | CSB-MP006240HU | Cusabio

Alternative Name(s): 10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10 Small-inducible cytokine B10

Gene Names: CXCL10

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-98aa

Sequence Info: Full Length of Mature Protein

MW: 12.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Reference: "Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins."Luster A.D., Unkeless J.C., Ravetch J.V.Nature 315:672-676(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway: Chemokinesignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02778

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose