Recombinant Human C-X-C motif chemokine 10 (CXCL10) (Active) | CSB-AP003501HU

Recombinant Human C-X-C motif chemokine 10 (CXCL10) (Active) | CSB-AP003501HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : C-X-C Motif Chemokine 10; 10 kDa Interferon Gamma-Induced Protein; Gamma-IP10; IP-10; Small-Inducible Cytokine B10; CXCL10; INP10; SCYB10

Gene Names: CXCL10

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 22-98aa

Sequence Info: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Biological Activity: The ED50 as determined by its ability to chemoattract human CXCR3 transfected BaF3 mouse proB cells is typically 0.02-0.06 μg/mL.

MW: 8.6 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types, such as monocytes, endothelial cells and fibroblasts, in response to IFN-γ. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles, such as chemoattraction for activated T-lymphocytes, inhibition of angiogenesis, and antitumor activity.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway: Chemokinesignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02778

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM