Recombinant Human C-type lectin-like domain family 1 (CLECL1), partial | CSB-BP811639HU

(No reviews yet) Write a Review
SKU:
CSB-BP811639HU
Availability:
3 - 7 Working Days
  • Recombinant Human C-type lectin-like domain family 1 (CLECL1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€443.00 - €1,472.00

Description

Recombinant Human C-type lectin-like domain family 1 (CLECL1), partial | CSB-BP811639HU | Cusabio

Alternative Name(s): Dendritic cell-associated lectin 1

Gene Names: CLECL1

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: KTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 89-167aa

Sequence Info: Partial

MW: 13 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May function in mediating immune cell-cell interactions. May act as a T-cell costimulatory molecule, enhancing anti-CD3-induced proliferation. May play a role in the interaction of dendritic cells with T-cells and the cells of the adaptive immune response.

Reference: "Dendritic cell-associated lectin-1: a novel dendritic cell-associated, C-type lectin-like molecule enhances T cell secretion of IL-4." Ryan E.J., Marshall A.J., Magaletti D., Floyd H., Draves K.E., Olson N.E., Clark E.A. J. Immunol. 169:5638-5648(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8IZS7

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose