Recombinant Human C-type lectin domain family 4 member D (CLEC4D), partial | CSB-EP841219HU

(No reviews yet) Write a Review
SKU:
CSB-EP841219HU
Availability:
13 - 23 Working Days
  • Recombinant Human C-type lectin domain family 4 member D (CLEC4D), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human C-type lectin domain family 4 member D (CLEC4D), partial | CSB-EP841219HU | Cusabio

Alternative Name(s): C-type lectin superfamily member -type lectin-like receptor 6 ;CLEC-6

Gene Names: CLEC4D

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 39-215aa

Sequence Info: Extracellular Domain

MW: 36.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells.

Reference: The human C-type lectin CLECSF8 is a novel monocyte/macrophage endocytic receptor.Arce I., Martinez-Munoz L., Roda-Navarro P., Fernandez-Ruiz E.Eur. J. Immunol. 34:210-220(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type II membrane protein

Protein Families:

Tissue Specificity: Expressed weakly in peripheral blood leukocytes, bone marrow and spleen. Expression is confined mostly in monocytes and macrophage and seems to be up-regulated by IL-6, IL-10, TNF-alpha and IFN-gamma.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8WXI8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose