Cusabio Active Proteins
Recombinant Human C-type lectin domain family 4 member C (CLEC4C), parial (Active) | CSB-EP855470HU
- SKU:
 - CSB-EP855470HU
 - Availability:
 - 3 to 7 Working Days
 
Description
Recombinant Human C-type lectin domain family 4 member C (CLEC4C) ,parial (Active) | CSB-EP855470HU | Cusabio
Protein Description: Extracellular Domain
Alternative Name (s) : Blood dendritic cell antigen 2 ;BDCA-2;C-type lectin superfamily member 7Dendritic lectin; CD303
Gene Names: CLEC4C
Research Areas: Immunology
Species: Homo sapiens (Human)
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 45-213aa
Sequence Info: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 μg/ml.
MW: 36 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test.
Relevance: Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.
PubMed ID:
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Lyophilized powder
Buffer: Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q8WTT0
Uniprot Entry Name:
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A