Recombinant Human C-C motif chemokine 18 (CCL18) | CSB-YP004781HU

(No reviews yet) Write a Review
SKU:
CSB-YP004781HU
Availability:
25 - 35 Working Days
  • Recombinant Human C-C motif chemokine 18 (CCL18)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$314.40 - $1,687.20

Description

Recombinant Human C-C motif chemokine 18 (CCL18) | CSB-YP004781HU | Cusabio

Alternative Name(s): Alternative macrophage activation-associated CC chemokine 1 ;AMAC-1CC chemokine PAR;CDendritic cell chemokine 1 ;DC-CK1Macrophage inflammatory protein 4 ;MIP-4Pulmonary and activation-regulated chemokine;Small-inducible cytokine A18

Gene Names: CCL18

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-89aa

Sequence Info: Full Length of Mature Protein

MW: 9.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Chotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.

Reference: Macrophage inflammatory protein-3 and -4.Li H., Ruben S.Patent number US5504003, 02-APR-1996A novel human CC chemokine PARC that is most homologous to macrophage-inflammatory protein-1 alpha/LD78 alpha and chemotactic for T lymphocytes, but not for monocytes.Hieshima K., Imai T., Baba M., Shoudai K., Ishizuka K., Nakagawa T., Tsuruta J., Takeya M., Sakaki Y., Takatsuki K., Miura R., Opdenakker G., van Damme J., Yoshie O., Nomiyama H.J. Immunol. 159:1140-1149(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine beta (chemokine CC) family

Tissue Specificity: Expressed at high levels in lung, lymph nodes, placenta, bone marrow, dendritic cells present in germinal centers and T-cell areas of secondary lymphoid organs and macrophages derived from peripheral blood monocytes. Not expressed by peripheral blood monocytes and a monocyte-to-macrophage differentiation is a prerequisite for expression. Expressed in synovial fluids from patients with rheumatoid and septic arthritis and in ovarian carcinoma ascitic fluid.

Paythway: Chemokinesignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55774

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose