Recombinant Human C-C motif chemokine 1 (CCL1) | CSB-EP004774HU

Recombinant Human C-C motif chemokine 1 (CCL1) | CSB-EP004774HU | Cusabio

Alternative Name(s): C-C motif chemokine 1(Small-inducible cytokine A1)(T lymphocyte-secreted protein I-309)

Gene Names: CCL1

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-96aa

Sequence Info: Full Length of Mature Protein

MW: 12.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.

Reference: "The human cytokine I-309 is a monocyte chemoattractant." Miller M.D., Krangel M.S. Proc. Natl. Acad. Sci. U.S.A. 89:2950-2954(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P22362

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A