Recombinant Human Butyrophilin subfamily 3 member A3 (BTN3A3), partial | CSB-EP002875HU

(No reviews yet) Write a Review
SKU:
CSB-EP002875HU
Availability:
13 - 23 Working Days
  • Recombinant Human Butyrophilin subfamily 3 member A3 (BTN3A3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Butyrophilin subfamily 3 member A3 (BTN3A3), partial | CSB-EP002875HU | Cusabio

Alternative Name(s): BT3A3_HUMAN; BTF3; BTN3A3; Butyrophilin subfamily 3 member A3

Gene Names: BTN3A3

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 30-248aa

Sequence Info: Extracellular Domain

MW: 39.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a role in T-cell responses in the adaptive immune response.

Reference: A 1.1-Mb transcript map of the hereditary hemochromatosis locus.Ruddy D.A., Kronmal G.S., Lee V.K., Mintier G.A., Quintana L., Domingo R. Jr., Meyer N.C., Irrinki A., McClelland E.E., Fullan A., Mapa F.A., Moore T., Thomas W., Loeb D.B., Harmon C., Tsuchihashi Z., Wolff R.K., Schatzman R.C., Feder J.N.Genome Res. 7:441-456(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a role in T-cell responses in the adaptive immune response.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families: Immunoglobulin superfamily, BTN/MOG family

Tissue Specificity: Detected in peripheral blood mononuclear cells and in T-cells (at protein level). Detected in spleen and lymphocytes.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O00478

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose