Recombinant Human Butyrophilin subfamily 3 member A2 (BTN3A2), partial | CSB-EP002874HU

Recombinant Human Butyrophilin subfamily 3 member A2 (BTN3A2), partial | CSB-EP002874HU | Cusabio

Alternative Name(s): BT3.2; BT3.3; BT3A2_HUMAN; BTF4; BTN3A 2; BTN3A2; Butyrophilin protein; Butyrophilin subfamily 3 member A2; Butyrophilin; subfamily 3; member A2; CD277; FLJ40011

Gene Names: BTN3A2

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 30-248aa

Sequence Info: Extracellular Domain

MW: 39.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.

Reference: The molecular basis for modulation of human Vgamma9Vdelta2 T cell responses by CD277/butyrophilin-3 (BTN3A)-specific antibodies.Palakodeti A., Sandstrom A., Sundaresan L., Harly C., Nedellec S., Olive D., Scotet E., Bonneville M., Adams E.J.J. Biol. Chem. 287:32780-32790(2012)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families: Immunoglobulin superfamily, BTN/MOG family

Tissue Specificity: Detected in T-cells and natural killer cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P78410

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM