Recombinant Human Bone sialoprotein 2 (IBSP), partial | CSB-EP010945HU(A4)

(No reviews yet) Write a Review
SKU:
CSB-EP010945HU(A4)
Availability:
3 - 7 Working Days
  • Recombinant Human Bone sialoprotein 2 (IBSP), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Bone sialoprotein 2 (IBSP), partial | CSB-EP010945HU(A4) | Cusabio

Alternative Name(s): Bone sialoprotein II

Gene Names: IBSP

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 129-281aa

Sequence Info: Partial

MW: 32.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment.

Reference: "Human bone sialoprotein. Deduced protein sequence and chromosomal localization." Fisher L.W., McBride O.W., Termine J.D., Young M.F. J. Biol. Chem. 265:2347-2351(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment.

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity:

Paythway: PI3K-Aktsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21815

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose