Recombinant Human Bone morphogenetic protein 6 (BMP6), partial | CSB-RP107094h

Recombinant Human Bone morphogenetic protein 6 (BMP6), partial | CSB-RP107094h | Cusabio

Alternative Name(s): VG-1-related protein ;VG-1-R ;VGR-1

Gene Names: BMP6

Research Areas: Developmental Biology

Organism: Homo sapiens (Human)

AA Sequence: QQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 382-513aa

Sequence Info: Partial

MW: 18.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Induces cartilage and bone formation.

Reference: Identification of transforming growth factor beta family members present in bone-inductive protein purified from bovine bone.Celeste A.J., Iannazzi J.A., Taylor R.C., Hewick R.M., Rosen V., Wang E.A., Wozney J.M.Proc. Natl. Acad. Sci. U.S.A. 87:9843-9847(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Induces cartilage and bone formation.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: TGF-beta family

Tissue Specificity:

Paythway: Hipposignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P22004

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM