Cusabio Human Recombinants
Recombinant Human Bone morphogenetic protein 3 (BMP3) | CSB-EP002739HU
- SKU:
- CSB-EP002739HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Bone morphogenetic protein 3 (BMP3) | CSB-EP002739HU | Cusabio
Alternative Name(s): Bone morphogenetic protein 3A ;BMP-3AOsteogenin
Gene Names: BMP3
Research Areas: Developmental Biology
Organism: Homo sapiens (Human)
AA Sequence: QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 363-472aa
Sequence Info: Full Length of Mature Protein
MW: 16.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.
Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: TGF-beta family
Tissue Specificity: Expressed in adult and fetal cartilage.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P12645
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM