Cusabio Human Recombinants
Recombinant Human Bone morphogenetic protein 15 (BMP15) | CSB-EP002735HU
- SKU:
- CSB-EP002735HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Bone morphogenetic protein 15 (BMP15) | CSB-EP002735HU | Cusabio
Alternative Name(s): Growth/differentiation factor 9B
Gene Names: BMP15
Research Areas: Developmental Biology
Organism: Homo sapiens (Human)
AA Sequence: QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 268-392aa
Sequence Info: Full Length of Mature Protein
MW: 21.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.
Reference: "Characterization of the post-translational modification of recombinant human BMP-15 mature protein." Saito S., Yano K., Sharma S., McMahon H.E., Shimasaki S. Protein Sci. 17:362-370(2008)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O95972
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A