Recombinant Human BH3-like motif-containing cell death inducer (BLID) | CSB-EP818276HU

(No reviews yet) Write a Review
SKU:
CSB-EP818276HU
Availability:
13 - 23 Working Days
  • Recombinant Human BH3-like motif-containing cell death inducer (BLID)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Human BH3-like motif-containing cell death inducer (BLID) | CSB-EP818276HU | Cusabio

Alternative Name(s): Breast cancer cell protein 2

Gene Names: BLID

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-108aa

Sequence Info: Full Length

MW: 39 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.

Reference: "BRCC2, a novel BH3-like domain-containing protein, induces apoptosis in a caspase-dependent manner." Broustas C.G., Gokhale P.C., Rahman A., Dritschilo A., Ahmad I., Kasid U. J. Biol. Chem. 279:26780-26788(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.

Involvement in disease:

Subcellular Location: Cytoplasm, Mitochondrion

Protein Families:

Tissue Specificity: Ubiquitously expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8IZY5

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose