Recombinant Human BH3-interacting domain death agonist (BID) | CSB-EP002698HU

Recombinant Human BH3-interacting domain death agonist (BID) | CSB-EP002698HU | Cusabio

Alternative Name(s): p22 BID ;BID

Gene Names: BID

Research Areas: Apoptosis

Organism: Homo sapiens (Human)

AA Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-195aa

Sequence Info: Full Length

MW: 38 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The major proteolytic product p15 BID allows the release of cytochrome c . Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.1 Publication

Reference: BID a novel BH3 domain-only death agonist.Wang K., Yin X.-M., Chao D.T., Milliman C.L., Korsmeyer S.J.Genes Dev. 10:2859-2869(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The major proteolytic product p15 BID allows the release of cytochrome c (By similarity). Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.

Involvement in disease:

Subcellular Location: Cytoplasm, Mitochondrion membrane, Note=When uncleaved, it is predominantly cytoplasmic, SUBCELLULAR LOCATION: BH3-interacting domain death agonist p15: Mitochondrion membrane, Note=Translocates to mitochondria as an integral membrane protein, SUBCELLULAR LOCATION: BH3-interacting domain death agonist p13: Mitochondrion membrane, Note=Associated with the mitochondrial membrane, SUBCELLULAR LOCATION: Isoform 1: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 2: Mitochondrion membrane

Protein Families:

Tissue Specificity: Isoform 2 and isoform 3 are expressed in spleen, bone marrow, cerebral and cerebellar cortex. Isoform 2 is expressed in spleen, pancreas and placenta (at protein level). Isoform 3 is expressed in lung, pancreas and spleen (at protein level). Isoform 4 is expressed in lung and pancreas (at protein level).

Paythway: p53signalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55957

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM