Recombinant Human Beta-defensin 4A (DEFB4A) | CSB-EP006705HU(A4)

(No reviews yet) Write a Review
SKU:
CSB-EP006705HU(A4)
Availability:
13 - 23 Working Days
  • Recombinant Human Beta-defensin 4A (DEFB4A)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Beta-defensin 4A (DEFB4A) | CSB-EP006705HU(A4) | Cusabio

Alternative Name(s): Beta-defensin 2

Gene Names: DEFB4A

Research Areas: Microbiology

Organism: Homo sapiens (Human)

AA Sequence: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-64aa

Sequence Info: Full Length

MW: 31.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells

Reference: "A peptide antibiotic from human skin." Harder J., Bartels J.H., Christophers E., Schroeder J.-M. Nature 387:861-861(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Beta-defensin family, LAP/TAP subfamily

Tissue Specificity: Expressed in the skin and respiratory tract.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O15263

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose