Recombinant Human Beta-defensin 124 (DEFB124) | CSB-EP836731HU

(No reviews yet) Write a Review
SKU:
CSB-EP836731HU
Availability:
13 - 23 Working Days
  • Recombinant Human Beta-defensin 124 (DEFB124)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Beta-defensin 124 (DEFB124) | CSB-EP836731HU | Cusabio

Alternative Name(s): Beta-defensin 24 ;DEFB-24Defensin, beta 124

Gene Names: DEFB124

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 23-71aa

Sequence Info: Full Length of Mature Protein

MW: 21.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has antibacterial activity.Curated

Reference: Discovery of five conserved beta-defensin gene clusters using a computational search strategy.Schutte B.C., Mitros J.P., Bartlett J.A., Walters J.D., Jia H.P., Welsh M.J., Casavant T.L., McCray P.B. Jr.Proc. Natl. Acad. Sci. U.S.A. 99:2129-2133(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has antibacterial activity.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Beta-defensin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8NES8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose