Recombinant Human B melanoma antigen 2 (BAGE2) | CSB-EP774832HU

(No reviews yet) Write a Review
SKU:
CSB-EP774832HU
Availability:
13 - 23 Working Days
  • Recombinant Human B melanoma antigen 2 (BAGE2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Human B melanoma antigen 2 (BAGE2) | CSB-EP774832HU | Cusabio

Alternative Name(s): Cancer/testis antigen 2.2

Gene Names: BAGE2

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: RLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEPTAFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 18-109aa

Sequence Info: Full Length of Mature Protein

MW: 17.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Unknown. Candidate gene encoding tumor antigens. Miscellaneous The ancestral BAGE gene was generated by juxtacentromeric reshuffling of the KMT2C/MLL3 gene. The BAGE family was expanded by juxtacentromeric movement and/or acrocentric exchanges. BAGE family is composed of expressed genes that map to the juxtacentromeric regions of chromosomes 13 and 21 and of unexpressed gene fragments that scattered in the juxtacentromeric regions of several chromosomes, including chromosomes 9, 13, 18 and 21.

Reference: "New BAGE (B melanoma antigen) genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 have a cancer/testis expression profile." Ruault M., van der Bruggen P., Brun M.-E., Boyle S., Roizes G., De Sario A. Eur. J. Hum. Genet. 10:833-840(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q86Y30

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose