Recombinant Human B-cell receptor-associated protein 31 (BCAP31), partial | CSB-RP034254h

(No reviews yet) Write a Review
SKU:
CSB-RP034254h
Availability:
3 - 7 Working Days
  • Recombinant Human B-cell receptor-associated protein 31 (BCAP31), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human B-cell receptor-associated protein 31 (BCAP31), partial | CSB-RP034254h | Cusabio

Alternative Name(s): 6C6-AG tumor-associated antigen;Protein CDMp28

Gene Names: BCAP31

Research Areas: Apoptosis

Organism: Homo sapiens (Human)

AA Sequence: SLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-243aa

Sequence Info: Partial

MW: 54.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmbrane proteins. May be involved in CASP8-mediated apoptosis.

Reference: Molecular cloning and characterization of a transmembrane surface antigen in human cells.Li E., Bestagno M., Burrone O.Eur. J. Biochem. 238:631-638(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmembrane proteins. May be involved in CASP8-mediated apoptosis.

Involvement in disease: Deafness, dystonia, and cerebral hypomyelination (DDCH)

Subcellular Location: Endoplasmic reticulum membrane, Multi-pass membrane protein, Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein

Protein Families: BCAP29/BCAP31 family

Tissue Specificity: Ubiquitous. Highly expressed in neurons and discrete endocrine cells.

Paythway: Proteinprocessinginendoplasmicreticulum

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P51572

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose