Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial (Active) | CSB-MP773799HU

(No reviews yet) Write a Review
SKU:
CSB-MP773799HU
Availability:
3 to 7 Working Days
  • Recombinant Human B- and T-lymphocyte attenuator (BTLA) ,partial (Active)
  • Recombinant Human B- and T-lymphocyte attenuator (BTLA) ,partial (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$219.60 - $351.60

Description

Recombinant Human B- and T-lymphocyte attenuator (BTLA) ,partial (Active) | CSB-MP773799HU | Cusabio

Protein Description: Partial

Alternative Name (s) : (B- and T-lymphocyte-associated protein) (CD272)

Gene Names: BTLA

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-Myc-tagged

Expression Region: 31-150aa

Sequence Info: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS

Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 μg/ml can bind biotinylated human TNFRSF14 (CSB-MP842173HU-A) , the EC50 is 137.8-233.4 ng/ml.

MW: 43.9 kDa

Purity: Greater than 94% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:12796776, PubMed:14652006, PubMed:15568026, PubMed:18193050) . May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14 (PubMed:19915044) . In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells (PubMed:19915044) .

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q7Z6A9

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose