Recombinant Human ATP-dependent RNA helicase DDX19B (DDX19B) (Active) | CSB-EP892352HU

(No reviews yet) Write a Review
SKU:
CSB-EP892352HU
Availability:
13 to 23 Working Days
  • Recombinant Human ATP-dependent RNA helicase DDX19B (DDX19B) (Active)
  • Recombinant Human ATP-dependent RNA helicase DDX19B (DDX19B) (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Human ATP-dependent RNA helicase DDX19B (DDX19B) (Active) | CSB-EP892352HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : DEAD box RNA helicase DEAD5 DEAD box protein 19B DBP5, DDX19, TDBP

Gene Names: DDX19B

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-479aa

Sequence Info: ATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 μg/ml can bind human DDX19B, the EC50 of human DDX19B protein is 17.71-23.15 μg/ml.

MW: 80.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test.

Relevance: ATP-dependent RNA helicase involved in mRNA export from the nucleus. Rather than unwinding RNA duplexes, DDX19B functions as a remodeler of ribonucleoprotein particles, whereby proteins bound to nuclear mRNA are dissociated and replaced by cytoplasmic mRNA binding proteins.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UMR2

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose