Recombinant Human Aspartoacylase (ASPA) | CSB-YP002223HU

(No reviews yet) Write a Review
SKU:
CSB-YP002223HU
Availability:
3 - 7 Working Days
  • Recombinant Human Aspartoacylase (ASPA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€339.00 - €1,345.00

Description

Recombinant Human Aspartoacylase (ASPA) | CSB-YP002223HU | Cusabio

Alternative Name(s): Aminoacylase-2 ACY2, ASP

Gene Names: ASPA

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH

Source: Yeast

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-313aa

Sequence Info: Full Length

MW: 39.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it act as a scavenger of NAA from body fluids.

Reference: "Examination of the mechanism of human brain aspartoacylase through the binding of an intermediate analogue." Le Coq J., Pavlovsky A., Malik R., Sanishvili R., Xu C., Viola R.E. Biochemistry 47:3484-3492(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it act as a scavenger of NAA from body fluids.

Involvement in disease: Canavan disease (CAND)

Subcellular Location: Cytoplasm, Nucleus

Protein Families: AspA/AstE family, Aspartoacylase subfamily

Tissue Specificity: Brain white matter, skeletal muscle, kidney, adrenal glands, lung and liver.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P45381

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose