Cusabio Human Recombinants
Recombinant Human Aquaporin-4 (AQP4), partial | CSB-EP001964HU
- SKU:
- CSB-EP001964HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Aquaporin-4 (AQP4), partial | CSB-EP001964HU | Cusabio
Alternative Name(s): Mercurial-insensitive water channel ;MIWCWCH4
Gene Names: AQP4
Research Areas: Transport
Organism: Homo sapiens (Human)
AA Sequence: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 253-323aa
Sequence Info: Partial
MW: 24 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous syst.
Reference: Megalencephalic leukoencephalopathy with subcortical cysts protein 1 functionally cooperates with the TRPV4 cation channel to activate the response of astrocytes to osmotic stress dysregulation by pathological mutations.Lanciotti A., Brignone M.S., Molinari P., Visentin S., De Nuccio C., Macchia G., Aiello C., Bertini E., Aloisi F., Petrucci T.C., Ambrosini E.Hum. Mol. Genet. 21:2166-2180(2012)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
Involvement in disease:
Subcellular Location: Membrane, Multi-pass membrane protein
Protein Families: MIP/aquaporin (TC 1.A.8) family
Tissue Specificity: Brain - muscle >> heart, kidney, lung, and trachea.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P55087
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM