Recombinant Human Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14) | CSB-EP887178HU

Recombinant Human Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14) | CSB-EP887178HU | Cusabio

Alternative Name(s): Apoptosis regulator Bcl-G

Gene Names: BCL2L14

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-327aa

Sequence Info: Full Length

MW: 63.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a role in apoptosis.

Reference: "Mutational and expression analysis of the chromosome 12p candidate tumor suppressor genes in pre-B acute lymphoblastic leukemia." Montpetit A., Larose J., Boily G., Langlois S., Trudel N., Sinnett D. Leukemia 18:1499-1504(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a role in apoptosis.

Involvement in disease:

Subcellular Location: Cytoplasm, SUBCELLULAR LOCATION: Isoform 1: Cytoplasm, cytosol, Note=Diffusely distributed throughout the cytosol, SUBCELLULAR LOCATION: Isoform 2: Endomembrane system

Protein Families: Bcl-2 family

Tissue Specificity: Isoform 1 is widely expressed. Isoform 2 is testis-specific.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BZR8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM