Recombinant Human Apolipoprotein L domain-containing protein 1 (APOLD1) | CSB-CF853458HU

(No reviews yet) Write a Review
SKU:
CSB-CF853458HU
Availability:
18 - 23 Working Days
  • Recombinant Human Apolipoprotein L domain-containing protein 1 (APOLD1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£1,124.80 - £1,822.40

Description

Recombinant Human Apolipoprotein L domain-containing protein 1 (APOLD1) | CSB-CF853458HU | Cusabio

Alternative Name(s): Vascular early response gene protein

Gene Names: APOLD1

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-279aa

Sequence Info: Full Length

MW: 33.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May be involved in angiogenesis. May play a role in activity-dependent changes of brain vasculature. May affect blood-brain permeability.

Reference: "Verge: a novel vascular early response gene." Regard J.B., Scheek S., Borbiev T., Lanahan A.A., Schneider A., Demetriades A.-M., Hiemisch H., Barnes C.A., Verin A.D., Worley P.F. J. Neurosci. 24:4092-4103(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96LR9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose