Recombinant Human Apolipoprotein B-100 (APOB), partial | CSB-YP001918HU

Recombinant Human Apolipoprotein B-100 (APOB), partial | CSB-YP001918HU | Cusabio

Alternative Name(s): Apolipoprotein B-48 Short name: Apo B-48

Gene Names: APOB

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 28-127aa

Sequence Info: Partial

MW: 13.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Reference: "Complete cDNA and derived protein sequence of human apolipoprotein B-100."Knott T.C., Wallis S.C., Powell L.M., Pease R.J., Lusis A.J., Blackhart B., McCarthy B.J., Mahley R.W., Levy-Wilson B., Scott J.Nucleic Acids Res. 14:7501-7503(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Involvement in disease: Hypobetalipoproteinemia, familial, 1 (FHBL1); Familial ligand-defective apolipoprotein B-100 (FDB)

Subcellular Location: Cytoplasm, Secreted

Protein Families:

Tissue Specificity:

Paythway: Cholesterolmetabolism

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04114

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM