Cusabio Human Recombinants
Recombinant Human Apolipoprotein B-100 (APOB), partial | CSB-EP001918HU
- SKU:
- CSB-EP001918HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Apolipoprotein B-100 (APOB), partial | CSB-EP001918HU | Cusabio
Alternative Name(s): Apo B-100
Gene Names: APOB
Research Areas: Epigenetics and Nuclear Signaling
Organism: Homo sapiens (Human)
AA Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 28-127aa
Sequence Info: Partial
MW: 27.2
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Apolipoprotein B is a major protein constituent of chylomicrons, LDL and VLDL. Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Reference: "Human liver apolipoprotein B-100 cDNA: complete nucleic acid and derived amino acid sequence." Law S.W., Grant S.M., Higuchi K., Hospattankar A.V., Lackner K.J., Lee N., Brewer H.B. Jr. Proc. Natl. Acad. Sci. U.S.A. 83:8142-8146(1986)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P04114
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A