Recombinant Human Annexin A8-like protein 2 (ANXA8L2) | CSB-EP726113HU

(No reviews yet) Write a Review
SKU:
CSB-EP726113HU
Availability:
13 - 23 Working Days
  • Recombinant Human Annexin A8-like protein 2 (ANXA8L2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Annexin A8-like protein 2 (ANXA8L2) | CSB-EP726113HU | Cusabio

Alternative Name(s): ANXA8L1; ANXA8L2Annexin A8-like protein 1

Gene Names: ANXA8L2

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-276aa

Sequence Info: Full Length of Isoform 2

MW: 57.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8." Karanjawala Z.E., Illei P.B., Ashfaq R., Infante J.R., Murphy K., Pandey A., Schulick R., Winter J., Sharma R., Maitra A., Goggins M., Hruban R.H. Am. J. Surg. Pathol. 32:188-196(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: Annexin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q5VT79

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose