Cusabio Human Recombinants
Recombinant Human Annexin A8-like protein 2 (ANXA8L2) | CSB-EP001990HU
- SKU:
- CSB-EP001990HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Annexin A8-like protein 2 (ANXA8L2) | CSB-EP001990HU | Cusabio
Alternative Name(s): ADP ribosylation factor 3; ADP-ribosylation factor 3; ARF3; ARF3_HUMAN; small GTP binding protein
Gene Names: ARF3
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: GNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-181aa
Sequence Info: Full Length
MW: 47.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Reference: "Interaction of the PDZ domain of human PICK1 with class I ADP-ribosylation factors." Takeya R., Takeshige K., Sumimoto H. Biochem. Biophys. Res. Commun. 267:149-155(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Involvement in disease:
Subcellular Location: Golgi apparatus, Cytoplasm, perinuclear region
Protein Families: Small GTPase superfamily, Arf family
Tissue Specificity:
Paythway: Endocytosis
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P61204
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM