Recombinant Human Annexin A6 (ANXA6), partial | CSB-RP007944h

(No reviews yet) Write a Review
SKU:
CSB-RP007944h
Availability:
13 - 23 Working Days
  • Recombinant Human Annexin A6 (ANXA6), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Annexin A6 (ANXA6), partial | CSB-RP007944h | Cusabio

Alternative Name(s): 67KDA calelectrin;Annexin VIAnnexin-6Calphobindin-II ;CPB-IIChromobindin-20Lipocortin VIProtein IIIp68p70

Gene Names: ANX6

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAV

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-245aa

Sequence Info: Partial

MW: 54.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May associate with CD21. May regulate the release of Ca2+ from intracellular stores.

Reference: Primary structure of the human, membrane-associated Ca2+-binding protein p68 a novel member of a protein family.Crompton M.R., Owens R.J., Totty N.F., Moss S.E., Waterfield M.D., Crumpton M.J.EMBO J. 7:21-27(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May associate with CD21. May regulate the release of Ca(2+) from intracellular stores.

Involvement in disease:

Subcellular Location: Cytoplasm, Melanosome

Protein Families: Annexin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08133

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose