Recombinant Human Annexin A5 (ANXA5) | CSB-YP001846HU

Recombinant Human Annexin A5 (ANXA5) | CSB-YP001846HU | Cusabio

Alternative Name(s): Anchorin CII;Annexin V;Annexin-5;Calphobindin I ;CBP-IEndonexin II;Lipocortin V;Placental anticoagulant protein 4 ;PP4Placental anticoagulant protein I ;PAP-I;Thromboplastin inhibitor;Vascular anticoagulant-alpha ;VAC-alpha

Gene Names: ANXA5

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-320aa

Sequence Info: Full Length of Mature Protein

MW: 37.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

Reference: Primary structure of human placental anticoagulant protein.Funakoshi T., Hendrickson L.E., McMullen B.A., Fujikawa K.Biochemistry 26:8087-8092(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

Involvement in disease: Pregnancy loss, recurrent, 3 (RPRGL3)

Subcellular Location:

Protein Families: Annexin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08758

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM