Recombinant Human Angiopoietin-like protein 8 (ANGPTL8) | CSB-EP757793HU

Recombinant Human Angiopoietin-like protein 8 (ANGPTL8) | CSB-EP757793HU | Cusabio

Alternative Name(s): Betatrophin1

Gene Names: C19orf80

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-198aa

Sequence Info: Full Length of Mature Protein

MW: 23.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels . May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids to adipose tissue for storage in the fed state .

Reference: Identification of genes differentially expressed in human hepatocellular carcinoma by a modified suppression subtractive hybridization method.Dong X.Y., Pang X.W., Yu S.T., Su Y.R., Wang H.C., Yin Y.H., Wang Y.D., Chen W.F.Int. J. Cancer 112:239-248(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels

Involvement in disease: Diabetes mellitus, insulin-dependent (IDDM); Diabetes mellitus, non-insulin-dependent (NIDDM)

Subcellular Location: Secreted

Protein Families: ANGPTL8 family

Tissue Specificity: Predominantly expressed in liver. Also expressed in adipose tissues.

Paythway: Cholesterolmetabolism

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6UXH0

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM