Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP) | CSB-CF846640HUb3

(No reviews yet) Write a Review
SKU:
CSB-CF846640HUb3
Availability:
18 - 23 Working Days
  • Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$1,626.00 - $2,674.80

Description

Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP) | CSB-CF846640HUb3 | Cusabio

Alternative Name(s): C6orf105

Gene Names: ADTRP

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-230aa

Sequence Info: Full Length

MW: 46.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells

Reference: "Next-generation sequencing to generate interactome datasets." Yu H., Tardivo L., Tam S., Weiner E., Gebreab F., Fan C., Svrzikapa N., Hirozane-Kishikawa T., Rietman E., Yang X., Sahalie J., Salehi-Ashtiani K., Hao T., Cusick M.E., Hill D.E., Roth F.P., Braun P., Vidal M. Nat. Methods 8:478-480(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: AIG1 family

Tissue Specificity: Expressed in cultured endothelial cells and in placenta.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96IZ2

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose