Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP) | CSB-CF846640HUb1

Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP) | CSB-CF846640HUb1 | Cusabio

Alternative Name(s): C6orf105

Gene Names: ADTRP

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-230aa

Sequence Info: Full Length

MW: 31.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells

Reference: "Associations between the CDKN2A/B, ADTRP and PDGFD polymorphisms and the development of coronary atherosclerosis in Japanese patients." Dechamethakun S., Ikeda S., Arai T., Sato N., Sawabe M., Muramatsu M. J. Atheroscler. Thromb. 21:680-690(2014)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: AIG1 family

Tissue Specificity: Expressed in cultured endothelial cells and in placenta.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96IZ2

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM