Recombinant Human Aminoacylase-1 (ACY1) | CSB-EP860799HU

Recombinant Human Aminoacylase-1 (ACY1) | CSB-EP860799HU | Cusabio

Alternative Name(s): N-acyl-L-amino-acid amidohydrolase

Gene Names: ACY1

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-408aa

Sequence Info: Full Length

MW: 72.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).

Reference: "The nucleotide sequence of human aminoacylase-1." Mitta M., Kato I., Tsunasawa S. Biochim. Biophys. Acta 1174:201-203(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).

Involvement in disease: Aminoacylase-1 deficiency (ACY1D)

Subcellular Location: Cytoplasm

Protein Families: Peptidase M20A family

Tissue Specificity: Expression is highest in kidney, strong in brain and weaker in placenta and spleen.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q03154

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM