Recombinant Human Amelogenin, X isoform (AMELX) | CSB-EP860753HU

Recombinant Human Amelogenin, X isoform (AMELX) | CSB-EP860753HU | Cusabio

Alternative Name(s): AI1E; AIH1; ALGN; Amel; Amelogenesis imperfecta 1; Amelogenin (amelogenesis imperfecta 1; X linked); Amelogenin (X chromosome); Amelogenin (X chromosome; amelogenesis imperfecta 1); Amelogenin; Amelogenin X isoform; Amelogenin; X linked; AMELX; AMELX_HUMAN; Amg; AMGL; AMGX; OTTHUMP00000022906; OTTHUMP00000022907; X isoform

Gene Names: AMELX

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 17-191aa

Sequence Info: Full Length of Mature Protein

MW: 35.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.

Reference: "A nomenclature for X-linked amelogenesis imperfecta."Hart P.S., Hart T.C., Simmer J.P., Wright J.T.Arch. Oral Biol. 47:255-260(2002).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.

Involvement in disease: Amelogenesis imperfecta 1E (AI1E)

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: Amelogenin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99217

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM