Recombinant Human Allograft inflammatory factor 1 (AIF1) | CSB-EP001490HU

Recombinant Human Allograft inflammatory factor 1 (AIF1) | CSB-EP001490HU | Cusabio

Alternative Name(s): Ionized calcium-binding adapter molecule 1;Protein G1

Gene Names: AIF1

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-147aa

Sequence Info: Full Length of Mature Protein

MW: 32.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Actin-binding protein that enhances mbrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

Reference: Characterization of a novel gene in the human major histocompatibility complex that encodes a potential new member of the I kappa B family of proteins.Albertella M.R., Campbell D.R.Hum. Mol. Genet. 3:793-799(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

Involvement in disease:

Subcellular Location: Cytoplasm, cytoskeleton, Cell projection, ruffle membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, phagocytic cup

Protein Families:

Tissue Specificity: Detected in T-lymphocytes and peripheral blood mononuclear cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55008

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM