Recombinant Human Alkaline phosphatase, placental type (ALPP), partial | CSB-EP001632HU1

(No reviews yet) Write a Review
SKU:
CSB-EP001632HU1
Availability:
3 - 7 Working Days
  • Recombinant Human Alkaline phosphatase, placental type (ALPP), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$319.20 - $1,728.00

Description

Recombinant Human Alkaline phosphatase, placental type (ALPP), partial | CSB-EP001632HU1 | Cusabio

Alternative Name(s): Alkaline phosphatase Regan isozyme Placental alkaline phosphatase 1 PLAP

Gene Names: ALPP

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 117-447aa

Sequence Info: Partial

MW: 41.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: In most mammals there are four different isozymes: placental, placental-like, intestinal and tissue non-specific (liver/bone/kidney).

Reference: "Nucleotide sequence of the human placental alkaline phosphatase gene. Evolution of the 5' flanking region by deletion/substitution." Knoll B.J., Rothblum K.N., Longley M.A. J. Biol. Chem. 263:12020-12027(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families: Alkaline phosphatase family

Tissue Specificity: Detected in placenta (at protein level).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P05187

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose